PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_008561-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 244aa    MW: 27757.9 Da    PI: 8.6452
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_008561-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WT+eEde+l++++k    ++W++Ia++++ gRt++++k++w+++
  AHYPO_008561-RA 14 KGAWTKEEDERLINYIKTRSQERWSLIAAKLP-GRTDNEIKNYWNTH 59
                     79******************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-22566IPR009057Homeodomain-like
PROSITE profilePS5129422.609964IPR017930Myb domain
SuperFamilySSF466894.52E-16970IPR009057Homeodomain-like
SMARTSM007174.9E-151362IPR001005SANT/Myb domain
PfamPF002495.9E-151459IPR001005SANT/Myb domain
CDDcd001671.53E-131660No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDERLINYIK TRSQERWSLI AAKLPGRTDN EIKNYWNTHI  60
KRKLISRGID PQTHRRLNST NTTTNTATNT IALTKLNTNN YRNKNTSHNN NTFQLINVQG  120
STLHFGHGSN LEYEFTTNDK GREKYYCTSI MPTIISKSSN IINEDSNNSS SVTIEEGYKE  180
INLELSISLP NYSSKISSNH EVMKNQQHYM MGYHVLGSAC LCSTLGFQNK DNECNCTMPI  240
SMN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675151.13e-82PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0J8FC074e-82A0A0J8FC07_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-33myb domain protein 7